SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010260 from Equus caballus 76_2

(show help)
Strong hits

Sequence:	ENSECAP00000010260
Domain Number 1	Region: 73-146
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	7.51e-17
Family	Complement control module/SCR domain	0.00024
Further Details:

Domain Number 2	Region: 198-259
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000000236
Family	Complement control module/SCR domain	0.001
Further Details:

Domain Number 3	Region: 130-200
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000000917
Family	Complement control module/SCR domain	0.00063
Further Details:

Domain Number 4	Region: 10-83
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.00000000000249
Family	Complement control module/SCR domain	0.0018
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSECAP00000010260 Gene: ENSECAG00000012425 Transcript: ENSECAT00000012975
Sequence length	261
Comment	pep:novel chromosome:EquCab2:5:30716812:30730874:1 gene:ENSECAG00000012425 transcript:ENSECAT00000012975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VLILFFLDACGDPLRYESMKLKGVAQPRYSPGATVEYECRLGYMLKRPPLPTSARCQANN TWTPLQEACTRKSCPHPGDPINGKVEYVNGTLTFGSQIHYFCNEGFNLIGTKILYCELVG ETVNWSDNPPLCQVMYCRPPPKIQNGKHSRSDQEEFRYGEVVVYTCDPSNGPDEYSLVGE SRLVCSGNDVWSSKPPECKVVKCEPPVLENGRVVSGFGKKFYYKATVVFDCLPGFYLSGN NTIVCGANSAWEPAIPTCIKG
Download sequence
Identical sequences	F6SQZ6 9796.ENSECAP00000010260 ENSECAP00000010260 ENSECAP00000010260

SEARCH