SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010799 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010799
Domain Number 1 Region: 199-336
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-38
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 2 Region: 482-617
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-34
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 790-916
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-33
Family C-type lectin domain 0.00043
Further Details:      
 
Domain Number 4 Region: 929-1079
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-32
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 5 Region: 1215-1355
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 6 Region: 625-774
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-26
Family C-type lectin domain 0.00076
Further Details:      
 
Domain Number 7 Region: 5-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.61e-25
Family Cysteine rich domain 0.0049
Further Details:      
 
Domain Number 8 Region: 1088-1206
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-24
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 9 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 10 Region: 388-470
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000787
Family C-type lectin domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010799   Gene: ENSECAG00000012627   Transcript: ENSECAT00000013590
Sequence length 1439
Comment pep:known_by_projection chromosome:EquCab2:11:16486589:16509303:-1 gene:ENSECAG00000012627 transcript:ENSECAT00000013590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPEPNVFLIFSHGLQGCLEAQGGQVRVSPGCNASLPAQRWKWVSRNRLFNLGTMQCLGT
GWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSLLLGGRASNTSKAGTPERGDQTRSG
QWRIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATT
QDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCG
VIRTESSGGWQNRDCSIALPYVCKKKPNATAEPPPPGEHPLPARRGPRSRPAQPHSTRCV
REQHSWRSELHVQGCGGMKTLSNYSVVQQHSITRELKHLHRGQWMSKLPTKLHMAGPWSA
GSCPSLTLWHVPLVPSQSPAHCSSLLAAWDPEGRWNDSPCNQSLPSICKKAGQLSQGAAE
EDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWD
GEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCT
VFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDPKLRHCYKVFSSDRLQDKKS
WVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPESHEQHWFWIGLNRRDPGGR
QSWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVMQCDTQLDWICKIPRGADVR
EPDVSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELASVHSQAELDFLGHNLQ
KFSRGQEQHWWIGLHTAESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYVTASREDW
GDQRCLTGLPYICKRSNSTRKTQPPDLPPTALGGCPSGWNQFLNKCFRIQGQDPQDRVKW
SEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDWIGLHASQKDFQWVEQEPLLYTNW
APGEPSGPSPAPSGNIPTSCTVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPS
PAALPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAHVPDPYTQAFLTQAARG
LRTPLWIGLASESRRYSWVSEEPLSYVSWQDGEPQQPGGCAYVDVDGTWRTTSCDTKLQG
AVCGGNRPPPPRRISYHGSCPQDLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGGA
VLSILDEMENVFVWEHLQSSEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGP
SMLSHNSCYWIQSSSGLWRPGACTNITMGVVCKLPRAEESTFSPSAALPENPAALVVVLM
AVLLLLALLTAALILYRRRQSVERGAFEGARYSRSSSSPGEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences F6SEM5
9796.ENSECAP00000010799 ENSECAP00000010799 ENSECAP00000010799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]