SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010872 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010872
Domain Number 1 Region: 45-163
Classification Level Classification E-value
Superfamily PX domain 0.00000000000000107
Family PX domain 0.0032
Further Details:      
 
Domain Number 2 Region: 245-299
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000196
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 842-872
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000349
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010872   Gene: ENSECAG00000013066   Transcript: ENSECAT00000013678
Sequence length 896
Comment pep:known_by_projection chromosome:EquCab2:3:34085811:34124217:-1 gene:ENSECAG00000013066 transcript:ENSECAT00000013678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTPRTETPVNSVSNSLENALHTSAHSTEESLPKRPVGKHSKVSVEKIDLKGLSHKKNER
NVECSFEVLWSDSSITSVTKSSSEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYVERNH
MDLEADLRYLASLPSHVLKNDHVKKFFSTSSPTQQLQSPSPGNPALSKVGTVMGVSGRPV
CGVAGIPSSQSSAQHHMQHAASAAALPHCSHTGGTGSALAYRTQMDTSPAILMPSSLQTP
QTQEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLEL
EKEKSEKRCLNPSAPAPVTSSGVARVPPTSHVGPVQAVRGSHAAALRVEVEQPSHQPARE
GSSSECSSSSPSPMGVQAREESSDSAEENDRRVEIHLEGSDKEKPVMLLNHFTSSSARPT
AQVLPVQNEAGSNPAGHHPLPPQMMTAASHIAPIRMLNSVHKSERGGADMKLLSSSMHSL
LSLEERSKVSGPRSGIKVDKSFGSAMMDVLPAAAAPQPMQVLSGLAESSSVSPTVSFGPR
AKVVHASALDRVMKPAPQPALVVETSTAAAGTSSTVFHVARPPIKLLVSSSVPADSAISG
QTSCSNNVQISVPPAIINPRTALYTANTKAAFSAMSSVPVGPLQGSFCANSNTASSSSHP
STSFANMATVPSCPAPSSSPALSSVPESSFYSSSGGGGSPGNIPASAQNHHHHHHHQQQP
APQQPAPGPPPGCVVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFPFPFLPFSPVCG
SGYVGAQQYGSGAFPVVHSPYSGSVPPEPVLGGQSTFAVPPMQNFMAGAAGVYQAQGLVG
SSNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences F6R166
ENSECAP00000010872 ENSECAP00000010872 9796.ENSECAP00000010872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]