SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010929 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010929
Domain Number 1 Region: 3028-3286
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-57
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 1269-1534
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 1892-2152
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-44
Family YWTD domain 0.000011
Further Details:      
 
Domain Number 4 Region: 3868-4142
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-44
Family YWTD domain 0.00000531
Further Details:      
 
Domain Number 5 Region: 1584-1841
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-44
Family YWTD domain 0.0000212
Further Details:      
 
Domain Number 6 Region: 536-771
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-40
Family YWTD domain 0.00000949
Further Details:      
 
Domain Number 7 Region: 201-464
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-38
Family YWTD domain 0.0000808
Further Details:      
 
Domain Number 8 Region: 2201-2470
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-34
Family YWTD domain 0.0000331
Further Details:      
 
Domain Number 9 Region: 2916-3020,3279-3340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1180-1261,1849-1887
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000337
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 848-890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.0000933
Further Details:      
 
Domain Number 12 Region: 3567-3607
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000013
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 13 Region: 929-968
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 14 Region: 3609-3645
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 15 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 16 Region: 1013-1050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 17 Region: 2692-2729
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 889-931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 19 Region: 3368-3412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 3651-3696
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 21 Region: 3486-3527
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 22 Region: 974-1011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 23 Region: 3776-3858
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000144
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 24 Region: 2732-2766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 1057-1097
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 26 Region: 3450-3485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 27 Region: 2814-2850
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000759
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 28 Region: 3410-3448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 29 Region: 2599-2638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000113
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 30 Region: 2772-2806
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000117
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 31 Region: 2852-2891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 32 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000124
Family EGF-type module 0.004
Further Details:      
 
Domain Number 33 Region: 3331-3366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 2524-2561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 35 Region: 3530-3568
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 36 Region: 802-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000029
Family EGF-type module 0.043
Further Details:      
 
Domain Number 37 Region: 1143-1178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 38 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 39 Region: 1106-1140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 40 Region: 2657-2688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 2560-2599
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000628
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 42 Region: 2155-2202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.011
Further Details:      
 
Domain Number 43 Region: 1545-1596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000605
Family EGF-type module 0.025
Further Details:      
 
Domain Number 44 Region: 4194-4229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000812
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000010929
Domain Number - Region: 486-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000671
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4231-4268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 2479-2539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4267-4302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 4373-4410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00371
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 117-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00782
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 4150-4182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4305-4338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0703
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010929   Gene: ENSECAG00000012166   Transcript: ENSECAT00000013743
Sequence length 4541
Comment pep:known_by_projection chromosome:EquCab2:6:74785294:74862230:1 gene:ENSECAG00000012166 transcript:ENSECAT00000013743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPPLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVHMSRLCNGVQDCVDGSDEGPHCRELRGHCSHLGC
QHHCVPTLNGPTCYCNNTFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYL
LQPDNRSCKAKNEPVDRPAVLLIANSQNILATYLSGTQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTDYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGNNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLEKAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGTAGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCNSLCLATPGSRQCACAEDQVLDTDGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWRCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHNDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRT
VSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEIIDAMQSQLGKATALAIMGDKLW
WADQVSEKMGTCNKADGSESVVLRNSTTLVMHMKVYDESIQLDHEGTNPCSVNNGECSQL
CLPTSGSTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
TDRVVLVNVSISWPNGISVDYQDGKIYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCA
VANGGCQQLCLYRGGGQRSCACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNL
NAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVE
NVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQNRPGAFERETVITMSGDDHPRAFVLD
ECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
IERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDI
PQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQEDFTCRAV
NSSCRAQDEFECANGECINFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCVS
NLLWCGADDCGDGSDEIPCNKTACGAGEFRCRDGTCIGNSSRCNQFVDCEDASDETNCSA
TDCSSYFRLGVKGVRFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYF
ACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGD
GSDEAAHCEGKTCGPNSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDDR
EFMCQNRQCIPKHFVCDHDRDCTDGSDESSECEYPTCGPSEFRCANGRCLSSRQWECDGE
NDCHDQSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERGCHI
NECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTHG
SYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVA
LDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDK
GRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSRS
VIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFE
DYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGC
SNLCLLSPGGGHKCACPTNFYLGGDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGD
HSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCT
NTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVD
GSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQF
RCKNNRCVPRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCAD
GSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQCN
NTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWAVLALPAVGSA
AAIPVSLYLHRPPSSPENPILLTFPESKLMNFFFISGAAACMKDCGGGFNVTCSIDPKLT
SCATNVSICGDEARCVRTENAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKG
SHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPSHPHSAYEQAFQGDESVRID
AMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGI
AIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNH
PKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAA
DSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYHQHK
QPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVAVPSPTPPPDAPRPGTCNLQ
CFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFT
GPKCTQQVCAGHCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAAD
GSRLCRCTAYFEGPRCEVNKCGRCLDGACVVNKQSGDVTCNCSDGRVAPSCLTCAGHCSN
GGSCTMNSKMMPECQCPPHMAGPRCEEQVASPQQPGHMASILIPLLLLLLMLLVAGAVFW
YKRRVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFT
NPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences F6Q221
ENSECAP00000010929 ENSECAP00000010929 9796.ENSECAP00000010929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]