SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011533 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011533
Domain Number 1 Region: 395-538
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 291-396
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-35
Family Second domain of FERM 0.00000386
Further Details:      
 
Domain Number 3 Region: 211-290
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-26
Family First domain of FERM 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011533   Gene: ENSECAG00000012838   Transcript: ENSECAT00000014426
Sequence length 994
Comment pep:known_by_projection chromosome:EquCab2:10:77117492:77224096:-1 gene:ENSECAG00000012838 transcript:ENSECAT00000014426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKEPDQLGADAAQEKPKEAAENQQPQPSDAEEEKGPQTSPTAESQSSPR
RQKREKEPSDSRGISRFLPPWLKKQKSYNLIVAKDGGEKKEPTQAVVEEQILDKEEPFPE
EERQAKGSAEVAAQRKQQETKVDVKEEKPAVRGPETQPAEEVSKEREEKVKEVQDDKSEE
AARRETKEVQTNELKAEKASQKAPKKTKTVPCKVTLLDGSEYSCDLEKRAKGQVLFDKVC
EHLNLLEKDYFGLLFQENPEQRNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDI
TRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPKEHGSNDLSDFQFAPNQT
KELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGL
LIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVC
VEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRAS
RSLDGAPIGDVDQSLMKDFPGPARDVSAYGPGVISPAVAEDGDGRRDVRSPARAPHVQLI
EGKKNSLRVEGDNIYVRHSNLMLEDLDKAQEDILRHQASISELKRNFMESTPEPRPNEWE
KRRITPLSLQTQGVFHMETLNVVEEKQQAEGWERLRRKSNPQKKELTLGVDPGERRKEGS
IINNAPTSLSSESSSSSEKEENCEYPPPTARVTEGTIREEQEEDEEEVEEEPGRAAKVVE
REAPVPAASAGPAGAGLSSVETVTQEHVVAPKIPAEKSLNEGAIEQAVSEEAEDQRHAVN
GEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQ
IDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQ
ALAQAIREAREQHPDMSVTRVVVHKETELEEGEE
Download sequence
Identical sequences F7AQJ9
ENSECAP00000011533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]