SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011589 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011589
Domain Number 1 Region: 644-836
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.4e-46
Family SPRY domain 0.0000568
Further Details:      
 
Domain Number 2 Region: 13-104
Classification Level Classification E-value
Superfamily RING/U-box 1.16e-29
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 3 Region: 350-441
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-20
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 4 Region: 104-167
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.48e-17
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 438-502
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.17e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011589   Gene: ENSECAG00000013655   Transcript: ENSECAT00000014493
Sequence length 838
Comment pep:known chromosome:EquCab2:7:74409645:74472142:1 gene:ENSECAG00000013655 transcript:ENSECAT00000014493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAVRAGWAGARRMATMTSAVLVDIRDEVTCPICLELLTEPASIDCGHSFCQACITRISKE
SMISQEGESSCPVCQSSYQPGNLRPNRHLANIAERVREVVLGSGKQLKVNLCAHHEEKLQ
LFCKEDGKLICWLCERSQEHRGHHTFLMEEVAQEYQEKFQESLKKLRQEQQEAEKLKAVI
REKRVSWKVREILPEGNQMEPERHRIQSQFNQLRSILDKEEQRQLKKLEEEGRKGLSIIE
EAEDELVHQSQSLRELISDLERRCQGSTMELLQDASEVTERSEFWTLKKPEALPTKLKSV
FRAPDLKKMLRVFRELTDVQSYWGKLQEEITRRARRTSGIRTRRSLESLTMALKILTNKQ
EEETCSVCLELLTESLSLGCGHSFCQTCITANNKEAEISPRGENGCPVCGIRYSLGNLWP
NQHLAKIVERLREVKLSPEEEQKRNLCVHHEEKLLLFCKEDRKVICWLCERSQEHRGHHT
SLMEEAVKECQEKLQAALERLRKEQQEAEKLEADVREKRTSWKYHIQTEKQRIQTEFNQL
RSILDSEEQRELNKLEEEEKKTLDTLAEAEDELVQQNQLVKELISDLERRSEWSTTQLLQ
DVSGIMKWSEIWKLKKPKTISKTLKSVFRAPDLSGMLHMFRELTHVQCYWVDITLNPVNL
NLNLILSEDQRQVTSVPIWPVEYYNYGILGSRYFSSGKHYWEIDVSKKNAWILGVYCRTR
SHNIKYDVRRGTNHPNVYSRYRPQYGYWVIGLQKESEYNAFEDSSTSDPHVLTLSVTVPP
HHVGVFLDCEGGTVSFFNVTNHGSLIYKFSKCRFSRTAYPYFNPWNCPAPMTLCPPSS
Download sequence
Identical sequences F7AF80
9796.ENSECAP00000011589 ENSECAP00000011589 ENSECAP00000011589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]