SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011798 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011798
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000011
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 4.43e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011798   Gene: ENSECAG00000013763   Transcript: ENSECAT00000014744
Sequence length 550
Comment pep:known_by_projection chromosome:EquCab2:12:25800277:26031018:-1 gene:ENSECAG00000013763 transcript:ENSECAT00000014744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPARSSASVPKPAPQPYPFTPSLSTINF
EEFSPMVFPSGTIPSQTSALAPAPAPVLAQAPAPAPAMASALAQAPAPVPVLAAGLAQAV
APPAPRTTQAGEGTLTEALLQLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQLLNQ
GVSMAPHTAEPMLMEYPEAITRLMSGSQRPPDPAPAPLGPGLPNGLLSGDEDFSSISDMD
FSALLSQISS
Download sequence
Identical sequences F7B9X5
9796.ENSECAP00000011798 ENSECAP00000011798 ENSECAP00000011798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]