SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011919 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011919
Domain Number 1 Region: 475-767
Classification Level Classification E-value
Superfamily L domain-like 1.7e-48
Family Ngr ectodomain-like 0.045
Further Details:      
 
Domain Number 2 Region: 30-431
Classification Level Classification E-value
Superfamily L domain-like 1.16e-38
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 3 Region: 864-1015
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.62e-26
Family Toll/Interleukin receptor TIR domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011919   Gene: ENSECAG00000014294   Transcript: ENSECAT00000014884
Sequence length 1031
Comment pep:known chromosome:EquCab2:16:35480731:35484970:1 gene:ENSECAG00000014294 transcript:ENSECAT00000014884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPCHGALQPLSLLVQAAMLAVALAQGTLPPFLPCELQPHGLVNCNWLFLKSVPHFSAAA
PRDNVTSLSLLSNRIHHLHDSDFAQLSNLQKLNLKWNCPPAGLSPMHFPCHMTIEPNTFL
AVPTLEELNLSYNGITTVPALPSSLVSLILSRTNILQLDPTSLTGLHALRFLYMDGNCYY
KNPCGRALEVAPGALLGLGNLTHLSLKYNNLTTVPRSLPPSLEYLLLSYNHIVTLAPEDL
ANLTALRVLDVGGNCRRCDHARNPCVECPHKFPQLHSDTFSHLSRLEGLVLKDSSLYQLN
PRWFRGLGNLTVLDLSENFLYDCITKTKAFQGLAQLRRLNLSFNYHKKVSFAHLTLAPSF
GSLLSLQELDMHGIFFRSLSQKTLQPLARLPMLQRLYLQMNFINQAQLGIFKDFPGLRYI
DLSDNRISGAVEPVATTGEVDGGKKVWLTSRDLTPGPLDTPSSEDFMPSCKNLSFTLDLS
RNNLVTVQPEMFAQLSRLQCLRLSHNSISQAVNGSQFVPLTSLQVLDLSHNKLDLYHGRS
FTELPRLEALDLSYNSQPFSMRGVGHNLSFVAQLPTLRYLSLAHNGIHSRVSQQLCSTSL
WALDFSGNSLSQMWAEGDLYLRFFQGLRSLIRLDLSQNRLHTLLPCTLGNLPKSLQLLRL
RNNYLAFFNWSSLTLLPNLETLDLAGNQLKALSNGSLPSGTQLQRLDVSRNSIIFVVPGF
FALATRLRELNLSANALRTVEPSWFGFLAGSLEVLDVSANPLHCACGAAFVDFLLQVQAA
VPGLPSRVKCGSPGQLQGRSIFAQDLRLCLDESLSWDCFGLSLLVVALGLAMPMLHHLCG
WDLWYCFHLGLAWLPRRGWQRGADALSYDAFVVFDKAQSAVADWVYNELRVRLEERRGRR
ALRLCLEERDWLPGKTLFENLWASVYSSRKMLFVLAHTDQVSGLLRASFLLAQQRLLEDR
KDVVVLVILSPDARRSRYVRLRQRLCRQSVLFWPHQPSGQRSFWAQLGMALTRDNRHFYN
QNFCRGPTMAE
Download sequence
Identical sequences Q2EEY0
NP_001075259.1.31192 ENSECAP00000011919 ENSECAP00000011919 9796.ENSECAP00000011919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]