SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012664 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000012664
Domain Number - Region: 249-333
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0133
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012664   Gene: ENSECAG00000014600   Transcript: ENSECAT00000015724
Sequence length 945
Comment pep:known_by_projection chromosome:EquCab2:16:43813532:43922946:-1 gene:ENSECAG00000014600 transcript:ENSECAT00000015724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVFPFRPPIGAQPLPGPCQGRLVRTNSRDVCNSTDLPEVEIISLLEEQLPHYKLRADT
IYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLE
EKERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTS
AAEESEPESVCSTPLKRNESSSSVQNYFHLDSLQKKLKDLEEENVVLRSEACQLKTETIT
YEEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQQEEITHLLSQIVDLQKKAKA
CTVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNLRNKTVPNTTS
RRYHSLGLFPMDSLAAEIEGTMRKELQLEEPESPDIAHQRRVFETVRNINQVVKQRSLTP
SPMNIPGSNQSSAVNSLLSSCVSTPRSSFYGSDVGNVVLDNKTNSIILEAESADLGNNER
SKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLRELAEKGELLSGSLTP
TESIMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGI
LDPRPGVVTKGFRTLDVDLDEVYCLNDFEEDDTGDHISLPGLATSTPVQHPETSAHHPGK
CMSQTNSTFTFTTCRILHPSDELTRVTPSLNSAPTPACGSASHLKSTPVATPCTPRRLSL
AESFTNIRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHSYTPRMTVIPS
TPPNSPMQTPMSSPPSFEFKCTSPPYDNFLASKPASSILREVREKKNVRSSESQTDVSVS
NLNLVDKVRRFGVAKVVNSGRAHVPTLTEEQGPLLCGPPGPAQALVPGGLVPEGLPLGCP
TLNSGIRRNRSFPTMVGSSMQMKAPVTLTSGILMGAKLPKQTSLR
Download sequence
Identical sequences F7CWZ2
ENSECAP00000012664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]