SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012808 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012808
Domain Number 1 Region: 235-377
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 131-236
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-37
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 3 Region: 50-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-27
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012808   Gene: ENSECAG00000014474   Transcript: ENSECAT00000015887
Sequence length 857
Comment pep:known_by_projection chromosome:EquCab2:8:30506316:30591862:-1 gene:ENSECAG00000014474 transcript:ENSECAT00000015887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVADKEQEFAAAAAKQLEYQQFEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVVLLDGS
EYGCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRNGAW
HFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDY
DPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDL
HHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFE
STIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRAS
ALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSVSAAEVGTGQYATTKGISQT
NLITTVTPEKKAEEERGEDEDRRKKAEEATPAAVVRQEGKTDSERTDTAADGETTATESD
QEEDAELKAQELDKTQDDLMKHQTNISELKRTFLETSTDTAITNEWEKRLSTSPVRLAAR
QEDAPMIEPLVPEETKQSTGEKLMDGSEIFSLLESARKPTEFIGGVTSASQSWVQKTETQ
AESTEGAQHPQPLSTEKVVQETVLVEERFVKHVHASGDASHVAGDDGDAAAQVASADASG
AKGKDGSALTEGAKEEKGEVADQAVLKPEEMATASHEPEEEPSAAIHISETLEPPFEASA
VKTEIISFGSVLPGGVKLEISTKEVPVVHTETKTITYESSQVDPGADLEPGVLMSAQTIT
SETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVT
KVVVHKETEITPEDGED
Download sequence
Identical sequences F7DW93
ENSECAP00000012808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]