SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013236 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013236
Domain Number 1 Region: 110-374,448-476
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 6.93e-89
Family Creatinase/aminopeptidase 0.0000000000329
Further Details:      
 
Domain Number 2 Region: 374-447
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.94e-26
Family Methionine aminopeptidase, insert domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013236   Gene: ENSECAG00000015390   Transcript: ENSECAT00000016389
Sequence length 477
Comment pep:known_by_projection chromosome:EquCab2:28:20518595:20553514:1 gene:ENSECAG00000015390 transcript:ENSECAT00000016389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVEEAASSGSHLNGDLDPDDREEGAASTAEEAAKKKRRKKKKSKGAATGQQEPDKESG
TSVDEVARQLERQALEEKERDDDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPIC
DLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRK
YVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTV
LQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDVG
EAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPIVKGGEATRMEEGEVY
AIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLD
RLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Download sequence
Identical sequences F6VDF8
XP_005606580.1.31192 XP_014706206.1.49734 ENSECAP00000013236 9796.ENSECAP00000013236 ENSECAP00000013236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]