SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013278 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013278
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.69e-48
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 1002-1060
Classification Level Classification E-value
Superfamily HMG-box 0.00000908
Family HMG-box 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013278   Gene: ENSECAG00000015412   Transcript: ENSECAT00000016438
Sequence length 1120
Comment pep:known_by_projection chromosome:EquCab2:24:3200199:3262672:-1 gene:ENSECAG00000015412 transcript:ENSECAT00000016438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATQKPMRYGHTEGHTDVCFDDSGSCIVTCGSDGDVRIWEDLDDDDPKSINVGEKAYSC
ALKNGKLVTAVSNNTVQVHTFPEGVPDGILTRFTTNANHVVFNGDGAKIAAGSSDFLVKV
VDVEDCSQQKTFRGHDAPVLSLSFDPKDIYLASSSCDGSVRVWQISDQTCAVSWPLLQKC
NDVINAKSICRLAWQPKSGKLLAVPVDKSVKLYRRETWSNQFDLSDNFISQTLNIVTWSP
CGQYLAAGSINGLIIVWNVETKDCLERVKHEKGYAVCGLAWHPTCGQIAYTDAEGNLGLL
ENVCDHNGKASSSKVSSRVEKDYNDLFDGDDTSNAGDFLNDNAVETPSFSKGIINDDEDD
DNLMLASGQDDENSVDVTMLKTGSGLLKEEEEDDQAGGIHNLPLVTSHRPFYDGPMPTPR
QKPFQSGSTPLHLTHRFMVWNSVGIIRCYNDEQDNAIDVEFHDTSIHHATHLSNTLNYTV
ADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIVDMPQNEDVEAICLGQGWAAAAS
SALLLRLFTIGGVQKEVFSLLGPVVSMAGHGEQLLIVYHRGTGFDGDQCLGVQLLELGKE
KKQILYGDPLPLTRKSYLVWQGGNTHGTPCYVDSEGIVRMLNRGFGNTWTPVCNTREHCK
GKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQIATEKGQMEEQF
WRSVMFHNHLDYLAKNGYEYEESTKNQAIKEQQELLMKMLALSCKLEREFRCVELADLMT
QNAVNLAIKYASRSRRLILAQRLSELAAEKAAELAATQVEQDKEEEEDFRKKLNAGYSNT
ATEWSQPSLGNQVEEDEEDTGEVDDVEEKPEIRKHGQNPFSKSANSADVPAIKSGAVTSS
SQGRVNPFKISANSKEPAISVNSRSANILDNMNKSSRKSLVLNRGTNNEKSPVIKPLVPK
PKSKQASAASYFQKTTSQDDKTEEVKEQNPKSSSSETPAVCPQNTENQRPKTGFQMWLEE
NRSNILSDNPDFVDEADIIKEGMIRFRALSTDERKAWATKGKGEAASDGVGAKKRKRVVD
ESHEAENQKEKAKETLNSPKKQKPLDLSTNQRLSTFAFKQ
Download sequence
Identical sequences F6V561
ENSECAP00000013278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]