SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013445 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013445
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily GFP-like 1.36e-61
Family Domain G2 of nidogen-1 0.00000548
Further Details:      
 
Domain Number 2 Region: 545-801
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-45
Family YWTD domain 0.000000089
Further Details:      
 
Domain Number 3 Region: 451-522
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.03e-20
Family Thyroglobulin type-1 domain 0.00089
Further Details:      
 
Domain Number 4 Region: 334-447
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.14e-19
Family Thyroglobulin type-1 domain 0.00081
Further Details:      
 
Domain Number 5 Region: 228-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000226
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 196-323
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000251
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013445   Gene: ENSECAG00000015369   Transcript: ENSECAT00000016636
Sequence length 813
Comment pep:known_by_projection chromosome:EquCab2:1:185511792:185556435:-1 gene:ENSECAG00000015369 transcript:ENSECAT00000016636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAISHIPQPAARALLPLTPIGGLFGWLFALEKPGWTNGFSLTGAAFTHDMEVTFHPGGER
LLVTQTAEGLDPENYLSIRTHIRGQAPYIPANLTVHVAPYKELYHYADSAVTSASSRDYA
LAAGAVNQTRSYRVLQNITFQACRHAPRPRAAPAVQQLSVDRVFAWYAEDEGVLRFALTS
LVGPAGGDSEPTPVNPCYDGSHACAMTARCRPGAGVDYSCECAPGYQGDGRSCADVNECA
TGFHRCGPNAMCVNLPGSYRCECRPGYEFADDGHTCRVVAPPPSPCEDGSHSCAPGQAQC
IPRGGGAFSCACLPGYSGDGHQCSDVDECSQDPCHPAASCHNTPGSFSCRCRPGYHGDGL
RCAPAPAPRRYPLSGLKPCERQQHEAQAQLAVPGAQLHVPQCDEHGHFVPLQCDSSTGSC
WCVDPDGHEVPGSQTRPGSAPPHCGPPEPTPRPRTVCERWRETLLELYGGAPGDDQYVPQ
CDEWGHFTPLQCHGRSDFCWCVDRDGREVPGTRSQPGTTPACVPTVAPPTVRPTPRPDVT
PPPVGTYLLYAQGQQIGHLPLNGTRLQKDAARTLLSLHGSIVVGIDYDCRERMVYWTDVA
GRTISRASLEPGAEPETIISSGLMSPEGLAIDHVRRTMYWTDSGLDKIERARLDGSERKA
LFHTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSSLEGENRRILVNKDIGLPNGLTFD
AFSKLLCWADAGTKRLECTLPDGAGRRVIQSSLNYPFSLVSYAGHFYHTDWRRDGVISVD
RDSGQFTDEYLPEQRSHLYGITAVHPYCPAGRK
Download sequence
Identical sequences F6VYL1
ENSECAP00000013445 9796.ENSECAP00000013445 ENSECAP00000013445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]