SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013564 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013564
Domain Number 1 Region: 35-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000212
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000013564
Domain Number - Region: 306-595
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000696
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013564   Gene: ENSECAG00000015885   Transcript: ENSECAT00000016775
Sequence length 597
Comment pep:novel chromosome:EquCab2:7:5049020:5069602:-1 gene:ENSECAG00000015885 transcript:ENSECAT00000016775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFCPPCPENASCYNSTHCACKDGFHSTAGRRYVTESSEKCEDIDECNTGLAKCKKKSYCR
NTIGSYYCSCVPNYPLFNWVAKFIKVNHPDCYVTNNSNVSGLKQHMFIVSWKNESKEHIA
KQATQVLQNVELAIWNTSFASPGKHENSEFDIVYETKKCNETSEKTLLEAGNNTMDIDCT
AAFKGARRGTRSTVAFITYRSLGDVLNGSFFDKRRGTLGVKLISHIMAGMNEKVDLSEPV
FLTFQHTQRGGARTEPFCVYWKGSEEGGSWSTEGCYHMGSNDSYTKCKCFHLSSFAVLLA
LAPKVPRFMLSALTVITYVGLSLSLLCLFLAALTFLLCRPIQNISTTLHLQFSICLFLAN
LLFLTGMDQTEPKVLCSIIAGVLHYLYLASFTWMLLEGLYLFLTVRNLTVANYTTIRRFN
KRFMYPFGYGIPAVIVAVSAIVGHKNYGTYTHCWLKVHKGFIWSFMGPVAVIILINLVFC
FLILWILRNKLSSLNKEVSTIQDTRVMTFKAIAQLFILGCSWGLGFFMVEEVGNTIGAVI
AYAFTIINVLQGFFLFLVHCLLNRQVRKEYRKWFSGMLKGVETESTEVSPSTTHTKM
Download sequence
Identical sequences F6UE34
ENSECAP00000013564 9796.ENSECAP00000013564 ENSECAP00000013564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]