SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013819 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013819
Domain Number 1 Region: 189-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-53
Family DBL homology domain (DH-domain) 0.00000157
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-26
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 4 Region: 658-759,836-862
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-24
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 5 Region: 786-864
Classification Level Classification E-value
Superfamily SH3-domain 2.04e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 6 Region: 561-647
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000761
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013819   Gene: ENSECAG00000015126   Transcript: ENSECAT00000017059
Sequence length 868
Comment pep:known_by_projection chromosome:EquCab2:25:35918809:36106356:-1 gene:ENSECAG00000015126 transcript:ENSECAT00000017059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHNV
AQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMAPLRLVLSPADMAAIFINLE
DLIKVHHSFLRAIDVSMMAGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLAGRE
DFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQSSIENLVITPHFLGGPSGEGLRASPRPPTQDSRDP
YLFLFDKVVIVCKRRGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGF
QFFCKTEDMKRKWMEQFEMAMSNIRPDKANANHHSFQMYTFDKTTNCKACRMFLRGTFYQ
GYLCTKCGVGAHKECLEVTPPCKISSPADLDTSGAGPGPKMVAVQNYHGNPPPPGKPVLT
FQTGDVIELLRGDPASPWWEGRLVQTRKSGYFPSLSVKPCPVDGRPPIGRPPSREIDYTA
YPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIH
ITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKARERAASRASSRSPASCASYNF
SLLSPQGLSFASQGSSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIG
GDQGWWKGETNGRIGWFPSTYVEEEGVQ
Download sequence
Identical sequences F6TWV8
ENSECAP00000013819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]