SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013942 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013942
Domain Number 1 Region: 326-428
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.72e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 55-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 137-191,218-233,261-276
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000014
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013942   Gene: ENSECAG00000015748   Transcript: ENSECAT00000017193
Sequence length 706
Comment pep:known_by_projection chromosome:EquCab2:1:90510444:90638140:-1 gene:ENSECAG00000015748 transcript:ENSECAT00000017193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMASDIPGSVALPVAPMAASGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSE
IERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKP
SFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPD
DVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDH
LPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAARTMPQESQDVTQGRGSC
LSAMGRSEVTSSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDI
LEFCHSEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEY
IICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQE
RDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFHPASGSSFSSSVVHVPGVNDIQ
SSSSTGQNMSQISRQLNQGQVAWTGSRPPFPGQVWASHSSKTQSSPFGIGTSHTYPADPS
SYSPLSSPATSSPSGNAYSGLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGE
QHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences F6W265
ENSECAP00000013942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]