SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014056 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014056
Domain Number 1 Region: 338-467
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-26
Family Ran-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014056   Gene: ENSECAG00000016276   Transcript: ENSECAT00000017312
Sequence length 469
Comment pep:known_by_projection chromosome:EquCab2:28:41166316:41179135:1 gene:ENSECAG00000016276 transcript:ENSECAT00000017312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDSGGAFKG
FKGLFVPSGGGGFSGFGSGAGGKPLEGLSNGNSVTGAPPFSSARAAAETKAAFGSIAANG
PTSLVDKKISNPKTNGDSQQPSSSGLTSSAAPVGNAYHKQLAALNCSVRDWIVKHVNTNP
LCDLTPIFKDYEKYLASIEQQHGNSGSSNSESEANKMSVETQSPSLFGSTKLQQESPFLF
HGNKTEDTSAKKLEAVSEKKTDPSLGATSASFNFGKKVDSSILGSLNSGPLTGFSFSSGN
SSLFGKDSTQNKPVPSPFSAKTLESPAEGGSNECKGGDEEENDEPPKVVVTEVKEEDAFY
SKKCKLFYKKDNEFKEKGVGTLHLKPTANQKTQLLVRADTNLGNILLNVLVPPNMPCART
GKNNVLIVCVPNPPVDEKNATIPVTMLIRVKTSEDADELHNILLEKKDV
Download sequence
Identical sequences F6XDP3
9796.ENSECAP00000014056 NP_001296247.1.31192 XP_005606830.1.31192 ENSECAP00000014056 ENSECAP00000014056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]