SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014281 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014281
Domain Number 1 Region: 644-866
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-41
Family DBL homology domain (DH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 1022-1223
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-32
Family Pleckstrin-homology domain (PH domain) 0.0000937
Further Details:      
 
Domain Number 3 Region: 853-970
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-22
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014281   Gene: ENSECAG00000016458   Transcript: ENSECAT00000017566
Sequence length 1225
Comment pep:known_by_projection chromosome:EquCab2:16:3635364:3735530:1 gene:ENSECAG00000016458 transcript:ENSECAT00000017566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDTEDAGKDPPESEGLATGTQEVEMATDSPDVSEEECEEATGGGDQNDQDGPPDQNEKN
DQEEMAAESEDPAQDEPAEESCQIIPFESDCVDNFVTALSGSPYEFFPTESTSFSSESCS
PFSESAKGLVSEQEPQSGACVEQDPVAGTPCGPCGSPQGGAGEDPSVPDVVVMPEDEDAA
DDALTNPYEMGVDLACEADPGEGEQPETQAASDALLGGYGMKEEMDPDAEGGLVPMDRMN
IVTRARPHSGKVAGYVPETVLEETGPEPGSSAIGMGGATKEMRKTVLSLEGKPLEASRAL
PAKPRAFTLYPRSFSVEGREIPVSIYREPEASGLDDHRIKRKDDNLSLPCVIGSSGSFSQ
RNHLPSSGTSTPSSVVDIPPPFDLACITKKPITKSSPSLLIESEPPDKHTKKKKSSFKRF
LALTFKKKSESKVHVDVSVSSRSSSESSHHGPSRLLELDRGSLSNSPQLKARTGKLRASE
SPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENI
PAMNSDYENIQIPPRRPARAGTFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSAD
PEAESAYTEPYKVCPISTAAPKEDLTSDAEQGSSEEEDSAPRDPSLTHKVEGQSRAHVIA
QELLSSEKAYVEMLQHLHVDFHEAVLRALDEMDQEGQDVSAREELRRSLSELPAIHDLHQ
GILEELEERLLNWEGQQKVADVFLAREEGFDHHATHILQFDRSLSLLSEHCLHSPQLAAA
VREFERSLQGGGQHVKHRLLRVVQRLFQYQVLLTDYLNNLCPDSPEYDNTQGALTLISKV
TDRANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMS
DVLLYTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETAESCLILSASSCAERDE
WHGCLSRALPEDYKAQALAAFHHSVEMRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSL
TLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCYGELKKRGGDVPGLMRERPVS
MSFPLSSPRFSSSAFSAVFHSISPSTFKKQKKAPSALTEVAASGEGSAISGYLSRCKKGK
RHWKKLWFVIKGKVLYTYMASEDTVAMESMPLLGFTIAPEKEEGSSEVGPVFHLYHKKTL
FYSFKAEDTSSAQRWIEAMEDASVL
Download sequence
Identical sequences F6WUL6
ENSECAP00000014281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]