SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015935 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015935
Domain Number 1 Region: 222-485
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-76
Family Protein kinases, catalytic subunit 0.00000000361
Further Details:      
 
Domain Number 2 Region: 116-256
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-35
Family SH2 domain 0.00000351
Further Details:      
 
Domain Number 3 Region: 53-138
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-21
Family SH3-domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015935   Gene: ENSECAG00000017938   Transcript: ENSECAT00000019467
Sequence length 500
Comment pep:known_by_projection chromosome:EquCab2:2:59653542:59671883:1 gene:ENSECAG00000017938 transcript:ENSECAT00000019467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVSSKKQVKEKEKGEWSPVKASTQSKDPPPLPPLVVFNHLPPAPPDTHPGQEEHFVVA
LYDYTAGNDRDLQMLKGEKLQILKEAGDWWLAKSLVTGREGYVPSNFVARVETVEVEKWF
FRSISRKDAERQLLAPVNKVGSFLIRESETSKGTLSLSVKDVTAQGEVIKHYKIRSLDEG
GYYITPRITFPTLQALVQHYSKKGDGLCQRLTQPSVSLAPQNPWAQDEWEIPRQSLKLVR
KLGSGQFGEVWMGYYKNNVKVAIKTLKEGTMSPEAFLGEANLMKTLQHERLVRLYAVVTK
EPIYIVTEYMARGCLLDFLKTDEGSKLSLPRLIDMSAQIAEGMAYIEQMNSIHRDLRAAN
ILVSETLCCKIADFGLARIIDNEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGILL
MEIVTYGRVPYPGMSNPEVVRSLERGYRMPRPDSCPPELYRGVIAECWRSRPEERPTFDF
LQSVLGDFYTATERQYEPQP
Download sequence
Identical sequences F7CU65
ENSECAP00000015935 ENSECAP00000015935 9796.ENSECAP00000015935 XP_001497997.1.31192 XP_008539751.1.77740 XP_008539752.1.77740 XP_008539753.1.77740 XP_014593298.1.31192 XP_014593299.1.31192 XP_014593300.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]