SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016104 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016104
Domain Number 1 Region: 274-422
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 381-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 163-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 197-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000395
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 5 Region: 504-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000548
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016104   Gene: ENSECAG00000018101   Transcript: ENSECAT00000019662
Sequence length 684
Comment pep:known_by_projection chromosome:EquCab2:28:41466402:41532567:1 gene:ENSECAG00000018101 transcript:ENSECAT00000019662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCTAGADVPLEACCADGHRMATQHRDCSLPYASESKECRMVQEQCCHNQLEELHCATGI
NLANEQDGCTTPYGDNASLEAMFVKRCCHCCLLGRAAQAQGQSCEYNLMVGYQCGLVFRA
CCVKGQETADFAPGDVGDLQETAKISEVKEEQEDPYLNDRCRGGGPCKQQCRDTGEEVVC
SCFVGYQLLPDGVSCEDINECITGSHNCRLGENCINTVGSFRCQRESSCGTGYELTENND
CKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPC
PVGQTCINTEGSYTCQKNVPNCGRGYHLNDEGTRCVDVDECSPPAEPCGPGHRCVNSPGS
FRCECKAGYYFDGISRTCIDINECRRYPGRLCGHKCENTPGSYFCSCTVGFRLLADGRSC
EDMNECNSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCI
NFPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSVNETCFNIQGGFRCLAFECPEN
YRRSADTLRQEKTDTVRCIKSCRPNDVTCVLDPVHTISHTVVSLPTFREFTRPEEIIFLR
AITPAYPANHADIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMN
YVVGGVVSHRNVVNVHIFVSEYWF
Download sequence
Identical sequences F7ABC9
9796.ENSECAP00000016104 ENSECAP00000016104 ENSECAP00000016104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]