SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016264 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016264
Domain Number 1 Region: 199-343
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-38
Family Second domain of FERM 0.000000725
Further Details:      
 
Domain Number 3 Region: 499-586
Classification Level Classification E-value
Superfamily Moesin tail domain 2.22e-32
Family Moesin tail domain 0.0000245
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-26
Family First domain of FERM 0.000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016264   Gene: ENSECAG00000018333   Transcript: ENSECAT00000019839
Sequence length 586
Comment pep:known_by_projection chromosome:EquCab2:31:1265009:1312846:-1 gene:ENSECAG00000018333 transcript:ENSECAT00000019839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKETHKSGYLGSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLREKEELMLRLQDYEEKTKK
AEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQMKSQEQLAAE
LAEYTAKIALLEEARRRKESEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVRENPQEEGTEYLGYSAELSSEGILGDRNEEKRITEAEKNERVQRQLMTLTSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences F7BPT4
ENSECAP00000016264 9796.ENSECAP00000016264 ENSECAP00000016264 XP_001492102.4.31192 XP_008523161.1.77740 XP_014713826.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]