SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016393 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016393
Domain Number 1 Region: 807-997
Classification Level Classification E-value
Superfamily Nucleotide cyclase 8.01e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 72-425
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-57
Family L-arabinose binding protein-like 0.00042
Further Details:      
 
Domain Number 3 Region: 503-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-43
Family Protein kinases, catalytic subunit 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016393   Gene: ENSECAG00000018813   Transcript: ENSECAT00000019991
Sequence length 1070
Comment pep:known_by_projection chromosome:EquCab2:6:42105527:42180124:-1 gene:ENSECAG00000018813 transcript:ENSECAT00000019991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTPLLGLALWSLLFYRGIISQVSQNCNDGYYEISVLMMNNSAFQESLDNLKEAVNEGIN
IVRWRLHEAGINVTVNATFIYSNGLIYKSSDCRSSTCEGLDLLRIISREKRMGCALMGPS
CTYSTFQMYLDTDLNYPMISAGSFGLSCDYKETLIRLMSPARKLMYFLVNFWKANNLPFK
TFSWSTAYVFKNGSESEDCFWYLNALEAGVSYFSQELIFKDVLRGDDQFQGILSNHKRKS
NVILMCGRPDVIHSLKGDRAVAEDIVIILVDLFNNHYFTDNVTAPDYMKNVLVLTLPPEN
STSNGSFFKDFSLAKNDFSLAYLDGVLLFGHMLKIFLESGEDVTTPKFAHAFRNLTFEGY
TGPVTLDDCGDIDNTMMLLYTSVETNKYKVLLTYDTHINGTKPVDMSPTFMWKNHKLPND
IPGQGPQILMIAVFTLAGTIILLLLIALLVLRKYKKENELRQKKWSHIPPEKIFPLETNE
TNHISLKIDDDKRRDTIQRLQQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQIDYYN
LTKFYGTVKLDTTIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGMSY
LHSSKIEVHGRLKSTSCVVDSRMVVKITNFGCNSILPPRKDLWTAPEHLRHASFSQKGDV
YSYGIIAQEIILRRETFYTSSCRDQNEKIFRVENSNGVKPFRPDLFLETAEEKELEVYLL
VKNCWEEDPEKRPDFKKIENTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERT
QLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPM
EVVDMLNDIYKSFDHILDHHDVYKVETIGDAYMVASGLPKRNGNRHAVDIAKMALDILSF
MGTFELEHLPDLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIH
VSGSTISILKRTECQFLYEVRGETYLKGRGTETTYWLTGVKDQEYNLPTPPTVENQQRLQ
AEFSDMIANSLQKRQASGIRSRKPTRIASYKKGTLEYLQLDTTDQESTHF
Download sequence
Identical sequences F7AV13
9796.ENSECAP00000016393 ENSECAP00000016393 ENSECAP00000016393 XP_001501748.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]