SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016642 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016642
Domain Number 1 Region: 65-129
Classification Level Classification E-value
Superfamily BPTI-like 4.54e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 2 Region: 32-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000000288
Family Elafin-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016642   Gene: ENSECAG00000019145   Transcript: ENSECAT00000020282
Sequence length 137
Comment pep:known_by_projection chromosome:EquCab2:22:34578216:34582616:-1 gene:ENSECAG00000019145 transcript:ENSECAT00000020282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLRLLPILVPFILLGAIQEPGLVEGTFNTMCPRTRVKCLHEERDQCTKNRHCPENMKC
CRFGCRKECLDLNKDVCSMPKESGPCMAFMPRWWYDKKTERCYRFIYGGCLGNNNNFQSE
AICRIICQGKSKSHWVF
Download sequence
Identical sequences F7B0U0
9796.ENSECAP00000016642 ENSECAP00000016642 ENSECAP00000016642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]