SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016718 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016718
Domain Number 1 Region: 877-1166
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000522
Family Rhodopsin-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016718
Domain Number - Region: 180-396
Classification Level Classification E-value
Superfamily YWTD domain 0.0011
Family YWTD domain 0.025
Further Details:      
 
Domain Number - Region: 514-558
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0275
Family Hormone receptor domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016718   Gene: ENSECAG00000018863   Transcript: ENSECAT00000020369
Sequence length 1489
Comment pep:known_by_projection chromosome:EquCab2:3:71767991:72529624:-1 gene:ENSECAG00000018863 transcript:ENSECAT00000020369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEYTAMWPSQLLIFMMLVAPIVHAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIE
SANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTY
KYLEVQYECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPW
TPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLR
TRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYT
LRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVD
VPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIH
LDSELERPPVREISTAGPLGMGSTTTSTTLRTTTWSQGRSTTPSVSGRRNRSTSTPSPAV
EVLDDITTHLPSASSQIPAQEESCEAVEAREIMWFKTRQGQVAKQPCPAGTIGVSTYLCL
APDGIWDPQGPDLSNCSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSVRA
MDQLVGLLDVQLRNLTPGGKDSAARSLNKLQKRERSCRAYVQAMVETVNNLLQPQALNAW
RDLTTSDQLRAATMLLDTVEESAFVLADNLLKTDIVRENTDNIQLEVARLSTEGNLEDLK
FPENMGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEAMSTNHS
VIVNSPVITAAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWST
QGCRLLTTNKTHTTCSCNHLTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLI
CIFTFCFFRGLQSDRNTIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAA
FTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWL
RLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKS
WVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEY
GKCLRTHCCSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGD
INSSASLNRGSYLPCIQACVSYLEGLLNNARDTSVMDTLPLNGNHGNSYSIASGEYLSNC
VQIIDRGYNHNETALEKKILKELTSNYIPSYLNNHERSSEQNRNLMNKLVNNLGGGSEDD
AIVLDDATSFNHEESLGLELIHEESDAPLLPPRVYSAENHQPHHYTRRRIPQDHSESFFP
LLTNEHTEDLQSPHRDSLYTSMPALAGVPTAESVTTSTQTEPPPAKCGDAEDVYYKSMPN
LGSRNHVHQLHTYYQLGRGSSDGFIVPPNKDGTPPEGSAKGPAHLVTSL
Download sequence
Identical sequences F7ACJ9
ENSECAP00000016718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]