SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016763 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016763
Domain Number 1 Region: 19-204,304-341
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-64
Family Calnexin/calreticulin 0.00012
Further Details:      
 
Domain Number 2 Region: 206-297
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.05e-22
Family P-domain of calnexin/calreticulin 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016763   Gene: ENSECAG00000018630   Transcript: ENSECAT00000020424
Sequence length 344
Comment pep:known_by_projection chromosome:EquCab2:21:1726333:1745920:-1 gene:ENSECAG00000018630 transcript:ENSECAT00000020424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGAPLWAVCVLRLALATVYFQEEFLDGERWRNRWVQSTNDSQLGHFRLSSGKFYGHK
EKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADVDQK
NLNGKSQYYIMFGPDICGFDIKKVHVILHFKNQYHSNKKSIRCKVDGFTHLYTLILRPDL
TYEVKIDSQSIEAGSIEYDWNLTSLKKMEKSSAESKDWAQAKDDKSQVFLKPEDWEKHFL
DASASKPSDWNSELDGDWPAPMLQKPPYQDGLKPEGIDKDVWLHQKMKNTNYLTEYDLSE
FENIGAIGLELWQVRSGTIFDNFLITDDEEYAENFGKTTWGETK
Download sequence
Identical sequences F7A7K1
9796.ENSECAP00000016763 ENSECAP00000016763 ENSECAP00000016763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]