SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017361 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017361
Domain Number 1 Region: 120-262
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 17-122
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-33
Family Second domain of FERM 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017361   Gene: ENSECAG00000019696   Transcript: ENSECAT00000021097
Sequence length 425
Comment pep:known_by_projection chromosome:EquCab2:1:145157363:145194336:1 gene:ENSECAG00000019696 transcript:ENSECAT00000021097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHWLEFTKSVVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQA
EIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLE
TYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQK
EEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRV
AKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGLESL
RDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADSVLPTPVAEHSLELM
LLSRQINGATCSIEEEKESEASTPTAAEVEALGGELRALCQGHSRPEEEQAMVCLQNPLS
GEPAH
Download sequence
Identical sequences F7E1J0
ENSECAP00000017361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]