SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017398 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017398
Domain Number 1 Region: 134-276
Classification Level Classification E-value
Superfamily PH domain-like 2e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 31-136
Classification Level Classification E-value
Superfamily Second domain of FERM 1.19e-32
Family Second domain of FERM 0.0000885
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017398
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000496
Family First domain of FERM 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017398   Gene: ENSECAG00000019696   Transcript: ENSECAT00000021142
Sequence length 501
Comment pep:known_by_projection chromosome:EquCab2:1:145157366:145194927:1 gene:ENSECAG00000019696 transcript:ENSECAT00000021142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCK
TSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPA
TSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKL
KFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSN
LFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRR
RAVHISIMEGLESLRDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADS
VLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTAAEVEALGGELRALCQGHSRP
EEEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYF
CPLRRWFACKIRSVVSLLIDT
Download sequence
Identical sequences F7DXB6
ENSECAP00000017398 ENSECAP00000017398 9796.ENSECAP00000017398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]