SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017664 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017664
Domain Number 1 Region: 51-168
Classification Level Classification E-value
Superfamily C-type lectin-like 1.71e-29
Family C-type lectin domain 0.00000426
Further Details:      
 
Domain Number 2 Region: 264-330
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 209-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 171-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017664   Gene: ENSECAG00000020122   Transcript: ENSECAT00000021448
Sequence length 373
Comment pep:known_by_projection chromosome:EquCab2:5:6105827:6122462:-1 gene:ENSECAG00000020122 transcript:ENSECAT00000021448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYRRTREGPGRAMIFPWKCQRAQRGLWNVFKLWVWTVLCCDFFTHHGTNCWTYHYSEKPM
NWSGARKFCQENYTDLVAIQNKGEIEYLNEVLPFNRNYYWIGIRKVGTTWTWVGTNKPLT
EEAENWGDGEPNNKKSKEDCVEIYIKRFRDAGKWNDDACHKNKTALCYTASCKPWSCSGH
GECVETINNNTCTCDVGYYGPQCQFVIQCEPLQAPELGTMACVHPLGNFSFSSQCVFNCS
EGREIVGIEETTCGPSGKWSSPEPTCQVIQCEPLTAPDLGTMDCSHPLADFSFTSTCTFN
CSEGTELIGERKTICGSSGIWSSTSPMCQKLDRSFTAIKEGDYNPLFIPVAVMVTALSGL
AFIIWLARRLKKG
Download sequence
Identical sequences F7E0Z9
ENSECAP00000017664 ENSECAP00000017664 9796.ENSECAP00000017664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]