SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017839 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017839
Domain Number 1 Region: 14-216
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.47e-22
Family Nuclease 0.026
Further Details:      
 
Domain Number 2 Region: 318-364,414-476
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000628
Family Nuclease 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017839   Gene: ENSECAG00000020213   Transcript: ENSECAT00000021647
Sequence length 509
Comment pep:known_by_projection chromosome:EquCab2:11:4163334:4192031:-1 gene:ENSECAG00000020213 transcript:ENSECAT00000021647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPWLLLGPLLSPTVPQVTSPPCCLCPEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFF
ELMKGQIKVAKRRVVMASLYLGTGPLEQELVDCLESTLEESLQTKFPSDLKVSILLDFTR
GSRGRKNSRTMLLPLLQRFPEQVRVSLFHTPNLRGLLRLLIPERFNETIGLQHIKVYLFD
NNVILSGANLSDSYFTNRQDRYVFLQDCPEVADFFTELVGAVGDVSLQLRGDDTVQVAEG
MVHPYKGDRAAYCQAANKRVMDVINSARTRQQMLHAQTFHSDSLWTQEDAAAAGDRRPAP
DTWIYPLIQMKPFEIHIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQ
ILLASPEVNGFFGAKGVAGAIPAAYVHIEQQFYSEVCSLGQQERVQLQEYWRRGWTFHAK
GLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEAQIAIVTESRALQQQLHQEQEQLYLRSG
VVSSATFEQPSRHVKLWVKMVTPLIKNFF
Download sequence
Identical sequences F7CEN1
ENSECAP00000017839 9796.ENSECAP00000017839 ENSECAP00000017839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]