SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018011 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018011
Domain Number 1 Region: 74-198
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018011   Gene: ENSECAG00000013574   Transcript: ENSECAT00000021838
Sequence length 205
Comment pep:known_by_projection chromosome:EquCab2:25:30710775:30734578:1 gene:ENSECAG00000013574 transcript:ENSECAT00000021838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAKFSRRPTCPDASVAGSLPTPPVPRHRKSHSLGNNRGRLYATLGPNWRVPVRNSPRTRS
CVYSPTGPCICTLGSSAAVPTMEGPLRRKTLLKEGRKPALSSWTRYWVILSGSTLLYYGA
KSLRGTDRKHYKSTPGKKVSIVGWMVQLPDDPEHPDIFQLNNPDKGNVYKFQTGSRFHAI
LWHKHLDDACKSNRPQVPANLMSFE
Download sequence
Identical sequences F6W7T0
ENSECAP00000018011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]