SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018018 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018018
Domain Number 1 Region: 1-384
Classification Level Classification E-value
Superfamily L domain-like 1.5e-66
Family Internalin LRR domain 0.049
Further Details:      
 
Domain Number 2 Region: 524-622
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 620-711
Classification Level Classification E-value
Superfamily Immunoglobulin 3.14e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 419-525
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-16
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018018   Gene: ENSECAG00000020312   Transcript: ENSECAT00000021846
Sequence length 1040
Comment pep:known_by_projection chromosome:EquCab2:6:76180217:76218733:-1 gene:ENSECAG00000020312 transcript:ENSECAT00000021846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSHNRLSSIKASSMSHLQSLREVKLNNNELETIPNLGPVSANITLLSLAGNRIVEILPE
HLKQFQSLETLDLSSNNISELKTAFPPLQLKYLYINSNRVTSMEPGYFDNLANTLLVLKL
NRNRIAAIPPKMFRLPQLQHLELNRNKIKNIDGLTFQGLGALKSLKMQRNGVTKLMDGAF
WGLSNMEILQLDHNNLTEVTKGWLYGLLMLQELHLSQNAISRISPDAWEFCQKLSELDLT
FNHLSRLDDSSFLGLSLLNTLHIGNNKVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMN
GAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNAFSQMKKLQQL
HLNTSSLLCDCQLKWLPQWVAENNFQSFVSASCAHPQLLKGRSIFAVSPDGFVCDDFPKP
QITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNELLHDAEMENYAHLRAQGGEV
MEYTTILRLRNVEFTSEGKYQCVISNHFGSSYSVKAKLTVNMLPSFTKTPMDLTIRAGAM
ARLECAALGHPAPQIAWQKDGGTDFPAARERRMHVMPEDDVFFIVDVKIEDIGVYSCTAQ
NSAGSISANATLTVLETPSFLRPLLDRTVTKGETAVLQCIAGGSPPPRLNWTKDDSPLVV
TERHFFAAGNQLLIIVDSDVSDAGKYTCEMSNTLGTERGSVRLSVIPTPTCDSPPMTASA
LDDDGWATVGVVIIAVVCCVVGTSLVWVVIIYHTRRRNEDCSITNTDETNLPADIPSYLS
SQGTLADRQDGYVSSESGSHHQFVTSSGGGFFLPQHDSNGTCHVDNSSEADVEVATDPFL
CPFLGSSGPVYLKGSGHGSGPFEAYPTGCGADLRTALMDHYEPSYIKKKECYPCPHPSEE
SCEQGVGDAGWPFHVRKFVSSTCSQGEGPGVRNMRLNKSSVDFSPGPEPASLTSSNSFLG
TFGKPLGRPHLDAFSSVGHLSDCQLRAFHLKARSSLDLDSESEKDGKERTDFQQENHTCT
YKQTLEHHRTPNFQSYDLDT
Download sequence
Identical sequences F6W7K8
ENSECAP00000018018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]