SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018025 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018025
Domain Number 1 Region: 1018-1084
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.03e-21
Family TB module/8-cys domain 0.00000887
Further Details:      
 
Domain Number 2 Region: 345-413
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1192-1253
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 4 Region: 798-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 676-798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000659
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 226-296
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000131
Family TB module/8-cys domain 0.0043
Further Details:      
 
Domain Number 7 Region: 593-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000565
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 546-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 9 Region: 915-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000355
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 292-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000706
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 1296-1381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 12 Region: 1136-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 13 Region: 77-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000233
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 1096-1145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000249
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018025
Domain Number - Region: 963-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018025   Gene: ENSECAG00000019691   Transcript: ENSECAT00000021853
Sequence length 1395
Comment pep:known_by_projection chromosome:EquCab2:15:63507478:63736435:-1 gene:ENSECAG00000019691 transcript:ENSECAT00000021853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHS
QQSGKALGTHVVHSTHTLPLTMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGP
TGQKVKEAQPGQSQVSYQGLPVQKTQTVHSTYSHQQVVPHVYPVAAKTQLGRCFQETIGS
QCGKALPGLSKQEDCCGTVGTSWGFNKCLKCPKKPSYHGYNQMMECLQGYKRVNNTFCQD
INECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTFSSCVPDTPVVSEEKGPCYRLVSSG
RQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPI
HHHVGKGPVFVKPKNTQLVAKSTHPPPLPAKEEPVEALTVSREHGPGVAEPEVATIPPEK
EIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPVPVEVAPEASTSSASQVI
APTQVTEINECTVNPDICGAGHCINLPVRYTCICYEGYKFSEQQRKCVDIDECTQVQHLC
SQGRCENTEGSFLCICPAGFMASEEGTNCRDVDECLRPDVCGEGHCINTVGAFRCEYCDS
GYRMTQGGHCEDIDECLIPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPK
VCTNGTCSNLEGSYMCSCHKGYTPTPDHKHCKDIDECQQGNLCINGQCKNTEGSFRCTCG
QGYQLSEAKDQCEDIDECQHHHLCSNGQCRNTEGSFRCVCDQGYRASALGDHCEDINECL
EDNSVCQGGDCINTEGSYDCTCPDGFQLNDNKGCQDTNECEQPGVCGPHGECLNTDGSFH
CVCEQGFSISADGRTCEDIDECVNNTICDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVD
VNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRASGDLYLDVDQPKEEK
KECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVLGTAEFTEMCPRGKG
FVPTGESSYDGDGENYKDADECLLFGQEICKNGFCLNTQPGYECYCKQGTYYDPVKLQCF
DMDECQDPNSCIDGQCINTEGSYNCFCTHPLVLDASEKKCIRPTESHEQIEETDVYQDLC
WEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVAGRRQ
PYGRDALVDFSEQYAPQPDPYFIQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCD
CFDGYHLDMAKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCLCLPGYVPSDKPNYCT
PLNAALNLEKDSDLE
Download sequence
Identical sequences F6W6Y4
ENSECAP00000018025 9796.ENSECAP00000018025 ENSECAP00000018025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]