SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018322 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018322
Domain Number 1 Region: 44-811
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-276
Family Motor proteins 0.000000000245
Further Details:      
 
Domain Number 2 Region: 1892-2008
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-22
Family Second domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 2009-2098
Classification Level Classification E-value
Superfamily PH domain-like 4.14e-19
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number 4 Region: 1193-1295
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000999
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number 5 Region: 1792-1900
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000107
Family Ras-binding domain, RBD 0.053
Further Details:      
 
Domain Number 6 Region: 1287-1381
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000116
Family Second domain of FERM 0.0057
Further Details:      
 
Domain Number 7 Region: 1506-1569
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000344
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 8 Region: 816-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000195
Family Motor proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018322   Gene: ENSECAG00000020054   Transcript: ENSECAT00000022187
Sequence length 2117
Comment pep:known_by_projection chromosome:EquCab2:18:3154614:3221832:-1 gene:ENSECAG00000020054 transcript:ENSECAT00000022187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSVGDHVWLNPTSANKTSVAIGGIIKETKPDKILVEDDEGKEHWIRAEDFGTLSPMH
PNSVQGVEDMIRLGDLNEAGIVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYYNRHMGELPPHVFAIANNCYFNMKRNKRDQCCVISGESGAGKTETTKLILQFLATISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLLGMSTEEKQLLGLGTPSEYRYLTMGNCTSCEGLNDAKDYAH
IRSAMKILMFSDSENWDLSKLLAAILHLGNVEFMAAVFENLDSSDVMETPAFPTAMKLLE
VKHEALRDCLIKHSIIVRGEFVTMPLNLAQAADRRDAFVKGIYGHLFLWIVKKINAAIFT
PPAQDPKNVRRAIGLLDIFGFENFENNSFEQLCINFANEHLQQLFVQHVFTMEQEEYRSE
GIAWDYIHYTDNRPTLDLLALKPMSIISLLDEESHFPQGTDITMLQKLNSVHANNKAFLQ
PRNIYDARFGIAHFAGKVYYQAEGFLEKNRDVLSTDILALVHSSENKFLREIFNLESAET
KLGRGTILKAKARNLLFKSTDSSKRPPTLAGQFKRSLDQLMKILTNCQPYFIRCIKPNEY
KKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYAFDEFARRFRVLLPSAERTQLRDKF
RQMTLRIAEMWLGTDKDWKVGKNKIFLKESHDVLLEVQRSQALDKAAVSIQRVLRGYKYR
KEFLRQRRAAVTIQAGWRGYCNRRNFKLILLGFERLQAIARSHQLAKQYQATRQRTVQLQ
ALCRGYLVRQQVQAKKRAVVVIQAHARGMAARRDFQRQKANGPLAIPAEEQKSRSALPTR
KRKSIYDTITDTEMVEQVFGFLPSMIGGQESQASPRFEDLEARSQQLPEVDLDTVPMVEE
PEEDLDDLAEYTFPKFAVTYFQKSASHTHLRRPLRYPLLYHEDSADCSAALAVWCIILRF
MGDLPEPVLFARNSLRGGSSVMQQIHDTLGRGNSTPSPQHSGSAQVASQLNIGEEAFEPD
GPISERPMSNLEKVHFIVGCAILRPSLRDEIYCQICKQLSENFKTSSVARGWILLSLCLG
CFPPSERFMKYLLNFIGHGPASYGPFCAERLRRTYANGVRTEPPTWLELQAVKSKKRIPI
HVILVTGERLTVMVDSASTSREVCLHIAHKQGLNDHLGFSLQVTVYDKFWSLGSGRDHVM
DAIAQCEQLAWERGEKERQAPWRIYFRKEFFTPWHDSREDPVSTQLIYRQVLLGILSGEY
SFEKEEELVELLARHCYVQLGASPGSEAVQELLPGCVPSKLYRTKSPEKWASLVTAAHTK
AQYTQKRATPLAVQEQVVDAARLQWPLLFSQLFEVTPLSGPRLPKTQLILAVNWKGLYFL
DQREKMLLELSFPEIMSLITNREALGGQRLLLSTLHKEEYEFLSPSSVAIAELVALFLEG
LKERSVFAMALQDRKATGDVTLLPFKKGDLLILTKKQGLLASENWILGQNDRTGKTGLVP
MAYLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQPPELSPDEQPKEPHTLEEFSYEFF
RAPEKETISRAVFPMGRTRGHLWAHSVEPLRQPLLKRVHASAELCDVASQAAAPILRYMG
DYPSRQAWTSLELSDQIFSLALQDPALQDEVYCQILKQLTHNTKRYSEERGWQLLWLCTG
LFPPGKALLPHAQKFIDTRRKKLLAPDCSRRLQRVLRTGPRKQPPHQVEVEAMEQNVSRI
CHKIYFPNDTSEMLEVGSNTRVRDVCNSISTTLQLASWEGCSLFIKIADKVISQKEGDFF
FDSLRHVSDWVKRNKPHREGAAVTLPYQVYFMRKLWLHVVPGKDVNADTILHYHQELPKY
LRGFHKCSREDAIHLAGLIYKAQFGNDRAHLASIPKILRELVPENLTRLMSSEEWRKSIL
LACEQHRDKTVEEAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDIILIAINRHGVLLIH
PKTKELLTTYPFTKIASWSSGSTYFHMVLGTLGRGSRLLCETSLGYKMDDLLTSYVQQLL
STVNKQRGSQAPALAEL
Download sequence
Identical sequences F6VHV7
ENSECAP00000018322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]