SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018465 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018465
Domain Number 1 Region: 44-789
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-277
Family Motor proteins 0.000000000263
Further Details:      
 
Domain Number 2 Region: 1951-2067
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-22
Family Second domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 2068-2157
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-19
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number 4 Region: 1251-1353
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000414
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number 5 Region: 1851-1959
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000011
Family Ras-binding domain, RBD 0.053
Further Details:      
 
Domain Number 6 Region: 1345-1439
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000012
Family Second domain of FERM 0.0057
Further Details:      
 
Domain Number 7 Region: 1566-1633
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000682
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 8 Region: 796-860
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000143
Family Motor proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018465   Gene: ENSECAG00000020054   Transcript: ENSECAT00000022351
Sequence length 2176
Comment pep:known_by_projection chromosome:EquCab2:18:3154614:3221149:-1 gene:ENSECAG00000020054 transcript:ENSECAT00000022351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSALQGDHVWLNPTSANKTSVAIGGIIKETKPDKILVEDDEGKEHWIRAEDFGTLSPMH
PNSVQGVEDMIRLGDLNEAGIVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYYNRHMGELPPHVFAIANNCYFNMKRNKRDQCCVISGESGAGKTETTKLILQFLATISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLLGMSTEEKQLLGLGTPSEYRYLTMGNCTSCEGLNDAKDYAH
IRSAMKILMFSDSENWDLSKLLAAILHLGNVEFMAAVFENLDSSDVMETPAFPTAMKLLE
VKHEALRDCLIKHSIIVRGEFVTMPLNLAQAADRRDAFVKGIYGHLFLWIVKKINAAIFT
PPAQDPKNVRRAIGLLDIFGFENFENNSFEQLCINFANEHLQQLFVQHVFTMEQEEYRSE
GIAWDYIHYTDNRPTLDLLALKPMSIISLLDEESHFPQGTDITMLQKLNSVHANNKAFLQ
PRNIYDARFGIAHFAGKVYYQAEGFLEKNRDVLSTDILALVHSSENKFLREIFNLEAPGA
HSSKRPPTLAGQFKRSLDQLMKILTNCQPYFIRCIKPNEYKKPLLFDRELCLRQLRYSGM
METVHIRKSGFPIRYAFDEFARRFRVLLPSAERTQLRDKFRQMTLRIAEMWLGTDKDWKV
GKNKIFLKESHDVLLEVQRSQALDKAAVSIQRVLRGYKYRKEFLRQRRAAVTIQAGWRGY
CNRRNFKLILLGFERLQAIARSHQLAKQYQATRQRTVQLQALCRGYLVRQQVQAKKRAVV
VIQAHARGMAARRDFQRQKANVGQRNTKRRLQVSAQERLKGRAQGDRARARASKRADPQT
RQQQASPAGPLAIPAEEQKSRSALPTRKRKSIYDTITDTEMVEQVFGFLPSMIGGQESQA
SPRFEDLEARSQQLPEVDLDTVPMVEEPEEDLDDLAEYTFPKFAVTYFQKSASHTHLRRP
LRYPLLYHEDSADCSAALAVWCIILRFMGDLPEPVLFARNSLRGGSSVMQQIHDTLGRGN
STPDQQMLRAGGEALRTPPHVKDKGIKGISSMKLKRSSRITGQVASQLNIGEEAFEPDGP
ISERPMSNLEKVHFIVGCAILRPSLRDEIYCQICKQLSENFKTSSVARGWILLSLCLGCF
PPSERFMKYLLNFIGHGPASYGPFCAERLRRTYANGVRTEPPTWLELQAVKSKKRIPIHV
ILVTGERLTVMVDSASTSREVCLHIAHKQGLNDHLGFSLQVTVYDKFWSLGSGRDHVMDA
IAQCEQLAWERGEKERQAPWRIYFRKEFFTPWHDSREDPVSTQLIYRQVLLGILSGEYSF
EKEEELVELLARHCYVQLGASPGSEAVQELLPGCVPSKLYRTKSPEKWASLVTAAHTKAQ
YTQKRATPLAVQEQVVDAARLQWPLLFSQLFEVTPLSGPRLPKTQLILAVNWKGLYFLDQ
REKMLLELSFPEIMTASLSRARTGTGPGLLLSTLHKEEYEFLSPSSVAIAELVALFLEGL
KERSVFAMALQDRKATGGCDVTLLPFKKGDLLILTKKQGLLASENWILGQNDRTGKTGLV
PMAYLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQPPELSPDEQPKEPHTLEEFSYEF
FRAPEKETISRAVFPMGRTRGHLWAHSVEPLRQPLLKRVHASAELCDVASAAPILRYMGD
YPSRQAWTSLELSDQIFSLALQDPALQDEVYCQILKQLTHNTKRYSEERGWQLLWLCTGL
FPPGKALLPHAQKFIDTRRKKLLAPDCSRRLQRVLRTGPRKQPPHQVEVEAMEQNVSRIC
HKIYFPNDTSEMLEVGSNTRVRDVCNSISTTLQLASWEGCSLFIKIADKVISQKEGDFFF
DSLRHVSDWVKRNKPHREGAAVTLPYQVYFMRKLWLHVVPGKDVNADTILHYHQELPKYL
RGFHKCSREDAIHLAGLIYKAQFGNDRAHLASIPKILRELVPENLTRLMSSEEWRKSILL
ACEQHRDKTVEEAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDIILIAINRHGVLLIHP
KTKELLTTYPFTKIASWSSGSTYFHMVLGTLGRGSRLLCETSLGYKMDDLLTSYVQQLLS
TVNKQRGSQAPALAEL
Download sequence
Identical sequences F6TQB8
ENSECAP00000018465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]