SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018547 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018547
Domain Number 1 Region: 15-372
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.93e-68
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 392-507,626-766
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.13e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018547
Domain Number - Region: 477-621
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00192
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018547   Gene: ENSECAG00000020215   Transcript: ENSECAT00000022439
Sequence length 831
Comment pep:known_by_projection chromosome:EquCab2:10:52459166:52868109:1 gene:ENSECAG00000020215 transcript:ENSECAT00000022439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQ
LSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSR
AILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEM
KRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTG
FRILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVGVQQFP
QMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEG
LEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDR
FEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLA
ITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVL
FVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGG
IWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSK
ISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGL
IDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQ
NIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKESSIWLVPPYHPDTV
Download sequence
Identical sequences F6VW97
ENSECAP00000018547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]