SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018966 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018966
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 8.9e-19
Family mono-SIS domain 0.0066
Further Details:      
 
Domain Number 2 Region: 29-279
Classification Level Classification E-value
Superfamily SIS domain 0.00000000667
Family mono-SIS domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018966   Gene: ENSECAG00000021347   Transcript: ENSECAT00000022922
Sequence length 625
Comment pep:known_by_projection chromosome:EquCab2:15:68799209:68819071:-1 gene:ENSECAG00000021347 transcript:ENSECAT00000022922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRFQHVIETPEPGKWELSGYEAALPITEKSNPLTRDLDKADAKQIVQLLGQCDAEI
FQEEGQAMPTYQRLYSDSVLTTMVQVAGKIQEVLKDPEGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMDNPAVFLPVLVGFNPVSMARNDPIEDWSSTFRQIAERMQNLQEKQ
EGFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDRGIATSQRCLLEILRTFE
RAHQVTYSQSPKIAALVKQASTSLEKKGQVYLVGWQTLGIIAIMDGVECIHTFGADFQDV
RGFLIGDHSDIFNQKADLINQGPQFSFSQEDFLTSILPSLKEIDTVVFIFTLDDNLTEVQ
TLVEQVKEKTSHIQALAHSTVGQSLPTTLKKLFPSIISITWPLLFFEYEGNFIQKFQHEL
STKWVLNTVSTGAHVLLGKILQNHMSDLRIRNSKLFWRALAMLQRFSGQPKAPCIESLLQ
VIHFPQPLSDDIRAAPISFHIQVAHEKEQVIPIALLSLLFRCSIPEAQAHLAAAPSVCEA
VRSALTGPGRKRSAEPLETLEPALQ
Download sequence
Identical sequences F6Q1E6
9796.ENSECAP00000018966 XP_001502228.2.31192 ENSECAP00000018966 ENSECAP00000018966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]