SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019071 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019071
Domain Number 1 Region: 79-345
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.85e-58
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 32-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000201
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019071   Gene: ENSECAG00000021580   Transcript: ENSECAT00000023043
Sequence length 346
Comment pep:known chromosome:EquCab2:3:21850633:21853753:-1 gene:ENSECAG00000021580 transcript:ENSECAT00000023043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALGAVVALLLWGQLFAVDTGNEATDFTDDSCPKPPEIPNGYVEHLVRYQCKNYYRLRSE
GDGVYALNSEKQWVNKASGTKLPECEAVCGKPKNPVDQVQRIIGGLLDAKGSFPWQAKLV
SRHNLTTGATLISEQWLLTTAQNLFLNHTPDAKPKDIAPTLKLYVGRKQPVEIEKVVFHP
DYQEVDIGLIKLKEKVPVGERVMPICLPSKDYAQVGRVGYVSGWGRNANFNFTELLKYVT
LPVADQDTCVKHYEGSTVPEKKTNRSSVGVQPILNEHTFCAGLSKFQEDTCYGDAGSAFV
IHDEEDDTWYAAGILSFDKSCAVAEYGVYVKVPSILDWVQKTIAEN
Download sequence
Identical sequences F6XWM5
ENSECAP00000019071 ENSECAP00000019071 9796.ENSECAP00000019071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]