SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019100 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019100
Domain Number 1 Region: 72-135
Classification Level Classification E-value
Superfamily BPTI-like 1.42e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0043
Further Details:      
 
Domain Number 2 Region: 31-79
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000419
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 3 Region: 138-183
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000589
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 4 Region: 180-228
Classification Level Classification E-value
Superfamily Elafin-like 0.00000209
Family Elafin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019100   Gene: ENSECAG00000021682   Transcript: ENSECAT00000023076
Sequence length 230
Comment pep:known_by_projection chromosome:EquCab2:22:34595938:34604123:-1 gene:ENSECAG00000021682 transcript:ENSECAT00000023076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLHSSTFSWRNVALLVLLFLSLEQTSASLSKKVKHKPGECPKERLTCTSKLPDSCKTDFN
CHEHLKCCSFACGKKCMDPYQEPCSLPLDPGNCESPARHWYFDFKDHLCKPFAYRGCDGN
ANNFFNREDCKTACSLAAKKGQCPLFPLKNRMMCSALCKSDIDCPQTEKCCESICGFVCA
TAWTVKAGFCPRKPTECSKIDKPKCLRDDDCPVSEKCCSRCGLKCMEPQN
Download sequence
Identical sequences F6WMJ9
ENSECAP00000019100 9796.ENSECAP00000019100 ENSECAP00000019100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]