SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019924 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019924
Domain Number 1 Region: 862-1043
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.73e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 1018-1139
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 158-192,225-372
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-29
Family Phosphotyrosine-binding domain (PTB) 0.0064
Further Details:      
 
Domain Number 4 Region: 13-157
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-19
Family Phosphotyrosine-binding domain (PTB) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019924   Gene: ENSECAG00000022162   Transcript: ENSECAT00000024010
Sequence length 1257
Comment pep:known_by_projection chromosome:EquCab2:3:88943867:89148860:-1 gene:ENSECAG00000022162 transcript:ENSECAT00000024010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTVRRHPFPNEVSVDFSLQLVGSLPVHSLTTMPMLPWVVAEVRRLSGQSSKKEPG
IRQVRLCVLPSGLKCEPEPGKSQQWDPLICSSIFECKPQHVHKLIHNSHDPSYFACLIKD
NAANQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDSFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKAEFDLGPVGNGEQGRRPMRKSFSQPGLRSLAF
KREFQDGGLRTSSSIFSSFEENDIENHLISGHNIVQPTDIEENRTMLFTIGQSEVYLISP
DTKKIALEKNFKEISFCSQGIRHVDHFGFICREASGGGGFLFVCYVFQCTNEALVDEIMM
TLKQAFTVAAVQQTARAPGQLCEGCPLQGLHRLCERIEGLSSSKTKLELQKHLTTLTNQE
QATIFEEVQKLRPRNEQRENELIMSFLRCLYEEKQKVHSHTGETKQTSQIAAENIGSEIA
PSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSASLDLDSSVSSTLSNTSKEP
SVCEKEALPVSESSFRLLGSSDDLSSDSESHPAEEPAPLSPQQAFRRRANTLSHFPVESH
EPPEPAQGSPGVSQRKLTRYHSVSTETPHERNVDHPPVGESKSCSGQSSAPAPPPRLNPS
ASSPNFFKYLKHNSSGEQSGNAVPKSISYRNALRKKLHSSSSVPNFLKFLAPVDENNTSD
FMNTKRDFQSKANHLGDASGTPVKTRRHSWRQQIFLRVATPQKACDSPGRYEDYSELGEL
PPRSPLEPVCEDGPFGPVPEEKKRTSRELRELWQKAILQQILLLRMEKENQKLQASENDL
LNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKVHSAVGQGVPRHQRGEIWK
FLAQQYHLKHQFPSKQQPEDTPYKELLKQLTSQQHAILIDLGRTFPTHPYFSAQLGAGQL
SLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMGEEEAFNMLKFLMFDMGLRKQYRPDMI
ILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTVFASQFPLGFVARVFDMIF
LQGSEVMFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQMEKTINQVFEMDIS
KQLQAYEVEYHVLQEELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLEQLQVANGRIQSL
EATVEKLLTSESKLKQASLALELERSALLQMVEELRRQTAQPGGADPDLTQPEPTGD
Download sequence
Identical sequences F7B8C2
9796.ENSECAP00000019924 ENSECAP00000019924 ENSECAP00000019924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]