SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020076 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020076
Domain Number 1 Region: 752-979
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-59
Family DBL homology domain (DH-domain) 0.000000000874
Further Details:      
 
Domain Number 2 Region: 348-524
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-56
Family Regulator of G-protein signaling, RGS 0.0000000243
Further Details:      
 
Domain Number 3 Region: 983-1117
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-43
Family Pleckstrin-homology domain (PH domain) 0.000000279
Further Details:      
 
Domain Number 4 Region: 26-119
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020076
Domain Number - Region: 147-157
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020076   Gene: ENSECAG00000022117   Transcript: ENSECAT00000024178
Sequence length 1559
Comment pep:known_by_projection chromosome:EquCab2:5:41344285:41389891:1 gene:ENSECAG00000022117 transcript:ENSECAT00000024178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMCFSYSFSRLNSLSLGDSAPERKSPSHHRQSSDTSETTGLVQRCVIIQKDQHGFGFTVS
GDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGS
SPASIGVSALQQDPAPAGAPRVTPVIPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQIL
RNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLYGD
TSQRSSEGRLSLDSQEGDSGLDSGTERFPSLSESLVNRNSVLSDPGLDSPRTSPVIIARA
AQHHRRQGSDAPVPSTSDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPA
HLGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKLPEV
LQAEIDLRLRSGEDMRGVLCEAQEAALPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGD
PLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPASTAEKAQSA
PDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKP
GNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMK
RSRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRKSIES
PSLGFCTDALLPHLLEDDLGQLSDLEPELDAQNWQHTVGKDVVSGLTQREIDRQEVINEL
FVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMRKLREE
GPIIKEISDLMLARFDGSAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAES
HPQCRRLQLRDLIISEMQRLTKYPLLLENIIKHTEGGTSEHEKLCRARDQCREILKYVNE
AVKQTENRHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTARKMIHEGPLTWRISKDKTL
DLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRA
FFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRHATRHPGAAPTPIHPPPPGPQEP
THPSPTASRAGLDDSEMFPAEPEPEELPGGTGPQQRVKGKHPVMLEAPEQPGRVEEEEVR
ALPHPAASLDVENRASRTRDPILLPLPDPLFMEGLASSLEDVENLQHLILWSLLPGHSVE
PQAAREPEDDLTPTPSVISITSHPWDPGSPGPAPTGGEGDNTQLPGPEGGRPEQEDVALC
SLEHLPPRTRNSGIWESPELDRNPEEETSSTEAAGSYKVVRKAEVAGSKVVPALPESGQS
EPEPPEVEGGAKATGNCFYVSMPAGPLDSSSDPSEVPTNPSQPDSLPAWQTEPRPQRLGS
NEDQRRPGHSPPSLALRDVGLIFRTIEQLTLKLNRLKDMELAHRELLRSLGGESSGGTTP
VGSFHTEAARWTNSTLSPPAKEPLASDSRDSQELGPCPEDGSDTPLEDSTAEAATSPGL
Download sequence
Identical sequences F6ZCH2
ENSECAP00000020076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]