SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020089 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020089
Domain Number 1 Region: 751-978
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-59
Family DBL homology domain (DH-domain) 0.000000000874
Further Details:      
 
Domain Number 2 Region: 347-523
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-51
Family Regulator of G-protein signaling, RGS 0.0000000367
Further Details:      
 
Domain Number 3 Region: 982-1116
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-43
Family Pleckstrin-homology domain (PH domain) 0.000000279
Further Details:      
 
Domain Number 4 Region: 25-118
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020089
Domain Number - Region: 146-156
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00392
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020089   Gene: ENSECAG00000022117   Transcript: ENSECAT00000024193
Sequence length 1558
Comment pep:known_by_projection chromosome:EquCab2:5:41344288:41389891:1 gene:ENSECAG00000022117 transcript:ENSECAT00000024193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFSYSFSRLNSLSLGDSAPERKSPSHHRQSSDTSETTGLVQRCVIIQKDQHGFGFTVSG
DRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSS
PASIGVSALQQDPAPAGAPRVTPVIPPPPPPPPLPPPQRITGPKPLQDPEFQKHATQILR
NMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDILPLYGDT
SQRSSEGRLSLDSQEGDSGLDSGTERFPSLSESLVNRNSVLSDPGLDSPRTSPVIIARAA
QHHRRQGSDAPVPSTSDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPAH
LGVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKLPEVL
QAEIDLRLRSGEDMRGVLCEAQEAALPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDP
LRERQVAEKQLAALGDIFLSHLFFLFAPMDFALNTYMSHAGIRLREARPASTAEKAQSAP
DKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKPG
NVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKR
SRKAENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKMGRKSIESP
SLGFCTDALLPHLLEDDLGQLSDLEPELDAQNWQHTVGKDVVSGLTQREIDRQEVINELF
VTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMRKLREEG
PIIKEISDLMLARFDGSAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESH
PQCRRLQLRDLIISEMQRLTKYPLLLENIIKHTEGGTSEHEKLCRARDQCREILKYVNEA
VKQTENRHRLEGYQKRLDTTSLERASNPLAAEFKSLDLTARKMIHEGPLTWRISKDKTLD
LHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAF
FIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRHATRHPGAAPTPIHPPPPGPQEPT
HPSPTASRAGLDDSEMFPAEPEPEELPGGTGPQQRVKGKHPVMLEAPEQPGRVEEEEVRA
LPHPAASLDVENRASRTRDPILLPLPDPLFMEGLASSLEDVENLQHLILWSLLPGHSVEP
QAAREPEDDLTPTPSVISITSHPWDPGSPGPAPTGGEGDNTQLPGPEGGRPEQEDVALCS
LEHLPPRTRNSGIWESPELDRNPEEETSSTEAAGSYKVVRKAEVAGSKVVPALPESGQSE
PEPPEVEGGAKATGNCFYVSMPAGPLDSSSDPSEVPTNPSQPDSLPAWQTEPRPQRLGSN
EDQRRPGHSPPSLALRDVGLIFRTIEQLTLKLNRLKDMELAHRELLRSLGGESSGGTTPV
GSFHTEAARWTNSTLSPPAKEPLASDSRDSQELGPCPEDGSDTPLEDSTAEAATSPGL
Download sequence
Identical sequences F7BSC7
ENSECAP00000020089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]