SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020913 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020913
Domain Number 1 Region: 232-501
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.13e-81
Family Protein kinases, catalytic subunit 0.000000000184
Further Details:      
 
Domain Number 2 Region: 141-266
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-31
Family SH2 domain 0.00000527
Further Details:      
 
Domain Number 3 Region: 51-173
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-21
Family SH3-domain 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020913   Gene: ENSECAG00000023256   Transcript: ENSECAT00000025147
Sequence length 510
Comment pep:known_by_projection chromosome:EquCab2:2:24528998:24535746:-1 gene:ENSECAG00000023256 transcript:ENSECAT00000025147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKATLPMRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHRYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPGPRDDGPSLSALRSWLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVK
HYKIRNLDKGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWE
VPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQR
LVRLYAVVTQEPIYIITEYMENGSLVDFLKTSTGIKLTINKLLDMAAQIAEGMAFIEERN
YIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTI
KSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMMLCWKE
RPEDRPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences F6USJ9
ENSECAP00000020913 9796.ENSECAP00000020913 ENSECAP00000020913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]