SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021637 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021637
Domain Number 1 Region: 57-193
Classification Level Classification E-value
Superfamily PH domain-like 0.00000676
Family Phosphotyrosine-binding domain (PTB) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021637   Gene: ENSECAG00000024193   Transcript: ENSECAT00000025976
Sequence length 199
Comment pep:known_by_projection chromosome:EquCab2:15:83948930:83961608:1 gene:ENSECAG00000024193 transcript:ENSECAT00000025976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTC
AEFRIKYVGAIEKLKLSEGKGLEGPLELINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEK
Download sequence
Identical sequences F6X476
9796.ENSECAP00000021637 ENSECAP00000021637 ENSECAP00000021637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]