SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021977 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021977
Domain Number 1 Region: 215-445
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 7.72e-17
Family Soluble quinoprotein glucose dehydrogenase 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000021977
Domain Number - Region: 638-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021977   Gene: ENSECAG00000024485   Transcript: ENSECAT00000026353
Sequence length 700
Comment pep:known_by_projection chromosome:EquCab2:2:87708857:87791598:-1 gene:ENSECAG00000024485 transcript:ENSECAT00000026353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGAFYPRLSCCLRSDSPGLGRLDNKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREALERDLELPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQIRGPASNYLDQMEEYDKVEEMSRKHKHNCFCIQEVVSGLRQPVSALHSGDGSH
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCSVPYSIPRSNPHFNSTSQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVSKQWQEKPLCLGNS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
Download sequence
Identical sequences F6YV89
ENSECAP00000021977 ENSECAP00000021977 9796.ENSECAP00000021977 XP_014693598.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]