SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022038 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022038
Domain Number 1 Region: 11-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000011
Family Ras-binding domain, RBD 0.054
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022038
Domain Number - Region: 100-123
Classification Level Classification E-value
Superfamily Second domain of FERM 0.022
Family Second domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022038   Gene: ENSECAG00000024553   Transcript: ENSECAT00000026422
Sequence length 128
Comment pep:known_by_projection chromosome:EquCab2:X:85014477:85018895:1 gene:ENSECAG00000024553 transcript:ENSECAT00000026422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYA
GPEQNHKFLLLQDKQPLAYVVQRTHYQGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQV
ESGLGIHR
Download sequence
Identical sequences F6SCP8
ENSECAP00000022038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]