SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022089 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022089
Domain Number 1 Region: 35-790
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.74e-280
Family Motor proteins 0.000000000132
Further Details:      
 
Domain Number 2 Region: 1987-2103
Classification Level Classification E-value
Superfamily Second domain of FERM 1.11e-22
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1246-1349
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 2104-2194
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1887-1995
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000336
Family First domain of FERM 0.061
Further Details:      
 
Domain Number 6 Region: 1341-1435
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000111
Family Second domain of FERM 0.0073
Further Details:      
 
Domain Number 7 Region: 1600-1670
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000145
Family SH3-domain 0.0042
Further Details:      
 
Domain Number 8 Region: 789-857
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000287
Family Motor proteins 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022089   Gene: ENSECAG00000024143   Transcript: ENSECAT00000026477
Sequence length 2208
Comment pep:known_by_projection chromosome:EquCab2:7:67131282:67196394:-1 gene:ENSECAG00000024143 transcript:ENSECAT00000026477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMHPTSVHG
VEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKK
IGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIE
QQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQA
PDERNYHVFYCMLEGMSEEQKRKLGLGGASDYNYLAMGNCIACEGREDSQEYANIRSAMK
VLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPCLATAASLLEVNPPDL
MTCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQEV
KNSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLH
IEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNSNYVPPKNNHE
TQFGIIHFAGVVYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQLFQADVAMGAETRKR
SPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIR
IRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQDDLRGTCQRMAEAVLGTHDDWQIGRTKI
FLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRRN
YELMRLGFLRLQALHRARKLHQQYRLARRHIIEFQARCRAYLVRRAFRHRLWAVLTVQAY
ARGLIARRLYRRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAR
EDAERELKEKEEARRKKELLEQMERARHEPINHSDMVDKMFGFLGTSGGLPGQEGQAPSG
FEDLERGRREMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTMHTYTRRPLKQPL
LYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRE
LQALQGEGEAQLPEGQKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGNSMLEDR
PTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSE
KFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMD
GTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQC
EQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKED
DLAELASQQYFVDYGSEMILERLLSLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQ
RRTEAQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPNLPKNDVIVAVNWTGVYFVDEQEQ
VLLELSFPEIMAVSSSRECRVLLSLGCSDLGCAAPHSGWAGLSPSGPCSPCWSCRGAKLT
APSFTLATIKGDEYTFTSSNSEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLS
FAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTMPPREIVALVTL
TPDQRQDVIRLLQQRTAEPEPRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWS
HTREPLKQALLKKILGSEELSQEACMAFIDIHTLGDGPHGGMRSVNELTDQIFEGALKAE
PLKDEVYVQILKQLTDNHIRSRTDRGWLQKLWLNTLAGWEPGSVSQVPSVLHSPWPHEPL
APDFATPHVFFRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDF
CQSIATRLLLKSSDGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSL
TYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFE
EDKSYFPSIPKLLRELVPQDLIRQISPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKW
PTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYF
HITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRGGK
Download sequence
Identical sequences F6S6L5
9796.ENSECAP00000022089 ENSECAP00000022089 ENSECAP00000022089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]