SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022153 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022153
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 48-97
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 6 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000565
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022153   Gene: ENSECAG00000024649   Transcript: ENSECAT00000026545
Sequence length 447
Comment pep:known_by_projection chromosome:EquCab2:13:8007733:8012374:-1 gene:ENSECAG00000024649 transcript:ENSECAT00000026545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADRVSQEPQALLESALPSSKVPAFANKDSLGDEMLAAALLKAKSRELVTFEDVAVY
FIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDGETRTEHDQEISEDTGSHGVLLGRLQKD
ISQGFKFEEAYEQEVTLKGQLGNSSGERLNRKIQDFGQVIVEENLSPRGERSEKYNDFGN
SFTVSSNLVSHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECSECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVMGMSRSSLRVTAELNIREST
Download sequence
Identical sequences F6RXM8
XP_001915564.3.31192 XP_005598668.1.31192 ENSECAP00000022153 ENSECAP00000022153 9796.ENSECAP00000022153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]