SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022516 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022516
Domain Number 1 Region: 333-679
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-91
Family YicI catalytic domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 683-765
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.94e-19
Family Putative glucosidase YicI, domain 3 0.011
Further Details:      
 
Domain Number 3 Region: 61-150,201-331
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000191
Family YicI N-terminal domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022516   Gene: ENSECAG00000024930   Transcript: ENSECAT00000026930
Sequence length 904
Comment pep:known_by_projection chromosome:EquCab2:1:146471925:146542533:-1 gene:ENSECAG00000024930 transcript:ENSECAT00000026930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEDEAVDKNIFKDCSNIAFYRRQKQQLSRKSMYRALLDSVTADRDSTRFQIINEATKAPL
LAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKLSTVRLTSCSGDSGSLVLADGKGDL
KCHITANPFKVDLVSEEEVVMSINSLGQLYFEHLQIPLKQRATKENEEDASVDTSQENQE
DLGLWEEKFGKFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNTGDGDAYRLYN
LDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEINTEPEVKYTLTQTGPA
AAKQKVTSRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSRLTGTQALPPLFSLGYHQCRW
NYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKRMQELLRSKKR
KLVVISDPHIKVDLDYSVYAKAKELGFFVRNHEGGDFEGVCWPGLSSYLDFTNPKVREWY
SGLFAFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHRELHNIYGFYHQM
ATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIPMLLTLSVTGI
SFCGADVGGFIGNPDAELLVRWYQAGAYQPFFRGHATMDTKRREPWLFGEEHTRLIREAI
RQRYTLLPYWYSLFYRAHVASEPVMRPLWIEFPDALEAFGVEDEYMLGSALLVHPVTELE
ATVVDVFLPGSNEVWYDSKTFTRWEGACTVKIPVDLDTIPVFQRGGSVVPIKTTIGKSTG
CMTDSPYGLRVALSTKGSAVGEFYLDDGHSFQYVHQKQFLHRKFSFCSGVLINSCADERG
RYPSKCVVEQIFILGLKKKPSSVTTHSSGGEDQPVAFVYCAKTSTLSLEKLSLDIGTDWE
VHVK
Download sequence
Identical sequences F6S9C5
9796.ENSECAP00000022516 ENSECAP00000022516 ENSECAP00000022516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]