SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022617 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022617
Domain Number 1 Region: 49-496
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.2e-95
Family Integrin alpha N-terminal domain 0.000000000343
Further Details:      
 
Domain Number 2 Region: 796-1011
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-52
Family Integrin domains 0.0000507
Further Details:      
 
Domain Number 3 Region: 498-654
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-43
Family Integrin domains 0.0000105
Further Details:      
 
Domain Number 4 Region: 655-789
Classification Level Classification E-value
Superfamily Integrin domains 5.49e-33
Family Integrin domains 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022617   Gene: ENSECAG00000024979   Transcript: ENSECAT00000027037
Sequence length 1058
Comment pep:known_by_projection chromosome:EquCab2:6:71199704:71220031:-1 gene:ENSECAG00000024979 transcript:ENSECAT00000027037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQWDSRSPWSPLHAVQLRWGPRRRPPLLPLLLPLLLLLLLPPPPRVGGFNLDAEAPAVLS
GPPGSFFGFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGEVYLCPWGASPAPCTPIEF
DSKGSRILDSSLSSPEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPV
GTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQI
LSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGV
PKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMER
TADGRPQEVGRVYVYLQHPAGMEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIG
APFGGETQQGVVFVFPGGPKGLGSKPSQVLLPLWAAGHSPDFFGSALRGGRDLDGNGYPD
LIVGSFGVDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASG
KHVPDSIGFTVELQLDWQKQKGGVRRALFLASRQAALTQTLLIENGAREDCREMKIYLRN
ESEFRDKLSPIHIALNFSLDPQAPVDSHGLQPVLHYQSKSRIEDKAQILLDCGEDNICVP
DLQLEVFGEQNHVYLGDKNSLNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNF
SSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLN
NSQSDVVSFRLSVEAQAQVSLNGVSKPEAVLFPVSDWHPRDQPQEEADVGPAVHHVYELI
NLGPSSISRGVLELSCPQALEGQQLLYVTRITGLSNCTTSHPPNPQGLELDPEGSQSHQL
QRREAPGRSPASSGPQILKCPEAECFRLRCELGPLHRQESLSLQLHFRVWAKTFLQREHQ
PFSLQCEAVYEALKMPYRILPRQLPRKELQVATAVQWTKAEGSHGVPLWIIILAILIGLL
LLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Download sequence
Identical sequences F6QLZ6
9796.ENSECAP00000022617 ENSECAP00000022617 ENSECAP00000022617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]