SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50118994|ref|YP_048161.1| from Pectobacterium atrosepticum SCRI1043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50118994|ref|YP_048161.1|
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily HAD-like 7.97e-42
Family YihX-like 0.000000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50118994|ref|YP_048161.1|
Sequence length 203
Comment phosphatase [Pectobacterium atrosepticum SCRI1043]
Sequence
MLYIFDLGNVVIDIDFKRVLGVWSNLSSAPLATLQERFVMGEAFEQHERGEISDEEFATR
LCQEMGIALSFEQFTAGWQAIFVALRPEVIDIMQRLRQEGHRVVILSNTNRLHCSHWPAL
FPEVATAADRLYLSQDIGLRKPELAIYQYVLTQEGVTPAQAVFFDDNSANVDAAQSLGIH
SILVTDRQVVTDFFAMQAITAKA
Download sequence
Identical sequences Q6DB69
218491.ECA0031 gi|50118994|ref|YP_048161.1| WP_011091677.1.17763 WP_011091677.1.79946 WP_011091677.1.80346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]